GLP-1
GLP-1
A research-use-only incretin-pathway peptide examined in bioenergetic models of glucose handling and cellular energy regulation. Studies focus on GPCR signaling, mitochondrial efficiency, and metabolic adaptability in controlled systems.
- Assesses incretin-linked energy signaling.
- Explores metabolic efficiency in vitro.
- ≥99% Pure | 5X Tested | PhD-Formulated | GMP/ISO
Price range: $42.34 through $111.64
Pick Your Concentration
Select Strength (MG)
*Disclaimer:
This product is intended solely for laboratory research purposes. It is not suitable for consumption by humans, nor for medical, veterinary, or household purposes.
Researchers should handle Agomelatine with care and adhere to strict safety guidelines during experiments. Kindly review our Terms & Conditions before making a
purchase.
GLP-1 | Product Description
GLP-1 | Introduction
GLP-1 (research-use-only) is evaluated in bioenergetic pathway studies of glucose regulation and cellular energy balance. Investigations probe GPCR-mediated signaling, mitochondrial efficiency under metabolic stress, and redox-responsive pathways in vitro. Not intended for diagnostic or therapeutic use.
- Incretin signaling and cAMP/PKA pathway mapping
- Energy balance and mitochondrial performance models
- Redox and stress-adaptation dynamics
Lab Tests
Latest Certificate of Analysis.
GLP-1 | Molecular Identity & Composition
| Name | Glucagon-Like Peptide-1 (7–36) amide (human) |
| Synonyms | GLP-1(7–36)-NH2 | GLP-1 (active form) |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| Molecular Formula | C149H226N40O45 |
| Molecular Weight | ≈3297.6 g/mol |
| CAS Number | 107444-51-9 |
| Appearance | White to off-white lyophilized powder |
| Solubility | Soluble in sterile water or bacteriostatic water |
| Purity | ≥99% (HPLC) |
| Storage Guidelines | • Lyophilized: ≤0°F (–18°C), dry, protected from light • Reconstituted: 36–46°F (2–8°C); avoid repeat freeze–thaw • Long-Term: Keep dry and frozen until use |
GLP-1 | Exciting Areas of Study
- Incretin-driven bioenergetic control and glucose handling
- Metabolic stress, mitochondrial efficiency, and redox responses
- Pathway cross-talk with insulin signaling in vitro
LuvionBio Quality Advantage
- Purity & Identity: ≥99% | HPLC & MS validated
- Endotoxin & Sterility: <0.05 EU/mg | Third-party verified
- Stability & Process: Controlled nucleation lyophilization | Stability-focused procedures
- Formulation & QA: PhD-formulated | GMP / ISO-aligned manufacturing
- Packaging: Luxe Fridge-Ready Box
Category Overview | Bioenergetic Pathway Modulators
Bioenergetic peptides are used in RUO studies to explore how cells generate, manage, and recover energy. These compounds interact with key metabolic pathways—especially mitochondrial ATP output and redox signaling—making them essential tools for researchers investigating energy dysfunction, oxidative stress, and cell viability under stress conditions.
Exciting Areas of Study
- Modulation of ATP output in energy-restricted cellular environments
- Pre-clinical insights into mitochondrial performance
- Stress-induced metabolic pathway behavior in controlled assays
- Early-stage models of energy dysregulation across tissue types
- Insulin sensitivity & glucose regulation in cell-based assays
Research Applications
- Map links between mitochondrial health and system-level decline
- Assess peptide influence on cellular energy balance and efficiency
- Examine how metabolic flexibility contributes to tissue regeneration
GLP-1 | Research Modeling & Applications
- Characterize incretin signaling vs. metabolic efficiency
- Evaluate stress-adaptation in high/low glucose models
- Profile redox-sensitive nodes in energy pathways
Research Use Disclaimer
This product is intended solely for laboratory research purposes. It is not suitable for human, animal, or household use. Researchers must follow institutional safety protocols. See our Terms & Conditions and our Research Compliance Disclaimers for details.
7 reviews for GLP-1
-
Awesome
great packaging quality
-
Peptides arrived in just two days, and were super high quality. will 100% coming back
-
arrived a day early
Didn’t expect it so soon — came one day early! Fast shipping for sure.
-
Customer service is A++++
Exceptional experience all around. LuvionBio’s team is knowledgeable, patient, and truly goes above and beyond to help. I felt valued and supported throughout the process. Highly recommend!
-
5 Stars
I had such a great experience with LuvionBio’s customer service. They were friendly, professional, and incredibly helpful from the start. They really took their time to explain everything and make sure I understood the products. Absolutely 5-star service!
-
Great customer service
They reached out to me, I got the wrong peptide and they changed it for free, super awesome customer service. Can’t wait to get my research products
-
Chilled on arrival
The peptides were delivered chilled and beautiful. I have ordered from other companies and Luvionbio is the best. Feel confident in them for my research.
jimmy –
great packaging quality
nick –
Peptides arrived in just two days, and were super high quality. will 100% coming back
james shockey –
Didn’t expect it so soon — came one day early! Fast shipping for sure.
Graham –
Exceptional experience all around. LuvionBio’s team is knowledgeable, patient, and truly goes above and beyond to help. I felt valued and supported throughout the process. Highly recommend!
Riley –
I had such a great experience with LuvionBio’s customer service. They were friendly, professional, and incredibly helpful from the start. They really took their time to explain everything and make sure I understood the products. Absolutely 5-star service!
Claire –
They reached out to me, I got the wrong peptide and they changed it for free, super awesome customer service. Can’t wait to get my research products
Grant –
The peptides were delivered chilled and beautiful. I have ordered from other companies and Luvionbio is the best. Feel confident in them for my research.